PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_13642
Common NameKK1_014059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 313aa    MW: 35600.8 Da    PI: 5.7017
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_13642genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W+ ++++ g+ R++k+c++rw +yl
    C.cajan_13642 14 RGLWSPEEDEKLIRYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding54.43e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+T+eE++l+++++   G++ W+ Ia++++ gRt++++k++w+++
    C.cajan_13642  67 RGRFTPEEEKLIINLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-25664IPR009057Homeodomain-like
PROSITE profilePS5129417.264961IPR017930Myb domain
SuperFamilySSF466893.41E-3011108IPR009057Homeodomain-like
SMARTSM007171.9E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001672.16E-111761No hitNo description
PROSITE profilePS5129425.81662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2565116IPR009057Homeodomain-like
SMARTSM007171.1E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1567111IPR001005SANT/Myb domain
CDDcd001674.09E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIRYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF TPEEEKLIIN LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKTS  120
VSSTTIAQSI DHNPSHFNFN SNVLDHFANQ DNLQTKPPVQ ETLFSSTCPL FMFDTSSLES  180
TATDHCNSVR VEPFQDAMGL STETWNLSHH QVQALPPITV TVGLDTTNYL PPLVENVDNM  240
VPIEVQSCNM DEHGDIALEC LQRQELNEWV ETQQQCANFL FWDNVDGQLG GEELAPNSSN  300
VEANNLSPFP SSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160103.10.0hypothetical protein PHAVU_002G292600g
TrEMBLA0A151SV210.0A0A151SV21_CAJCA; Transcription factor MYB86
STRINGGLYMA08G02080.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41123358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-101myb domain protein 103